DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and R05D8.9

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_503753.1 Gene:R05D8.9 / 187609 WormBaseID:WBGene00019886 Length:281 Species:Caenorhabditis elegans


Alignment Length:263 Identity:64/263 - (24%)
Similarity:114/263 - (43%) Gaps:57/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRWLNRVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQD-----IKSSLPADQAARFHT 60
            ::|:..:||:|||:|.|||.|........|..|....|..:.|::     :||.:|........|
 Worm     2 LSRFSGKVALVTGSSNGIGRAAAVLFAKDGAKVTVTGRNAERLEETRQEILKSGVPESHVLSVAT 66

  Fly    61 RPCDVSNEQQVIDTFAWIDRTLGGADVLVNNA-----------GIIRQMNITDPENSADVRAILD 114
            .......:.:::::..   :..|..|:|||||           |:.:.:::.|        .|:.
 Worm    67 DLAAEKGQDELVNSTI---QKFGRLDILVNNAGAAFNDDQGRVGVDQDVSVYD--------KIMQ 120

  Fly   115 VNVLGVTWCTRQWFLSLQRRKVNDGHVVVINSVVG--HSVPAVEGFSLNMYAPSKHAITALTEIL 177
            :|:..|...|::....|.:.|   |.:|.::|:.|  |:.|.|     ..||.||.|:...|...
 Worm   121 INMRSVVTLTQKAKEHLVKAK---GEIVNVSSIAGTAHAQPGV-----MYYAMSKSALDQFTRCA 177

  Fly   178 RQEFIKKGTQTKITSISPGVVATEIFEA-----GSWEQ------------PTGMPMLRSEDIADA 225
            ..:.|:.|  .::.|:|||.|.|...||     |::|:            |:| .:.:..|||:.
 Worm   178 AIDLIQYG--VRVNSVSPGGVTTGFGEAMGMPSGAFEEMMKFMESRKECIPSG-AVAKPIDIANI 239

  Fly   226 VTY 228
            :.:
 Worm   240 IAF 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 64/263 (24%)
NADB_Rossmann 1..245 CDD:304358 64/263 (24%)
R05D8.9NP_503753.1 fabG 4..266 CDD:235975 64/261 (25%)
NADB_Rossmann 5..266 CDD:304358 63/260 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D460854at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.