DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and dhs-18

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_505812.1 Gene:dhs-18 / 179529 WormBaseID:WBGene00000981 Length:293 Species:Caenorhabditis elegans


Alignment Length:211 Identity:53/211 - (25%)
Similarity:86/211 - (40%) Gaps:40/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVVTGASAGIGAACCRDLVAKGMVVVGLAR----REKVLQDIKSSLPADQAARFHTRPC--DV 65
            :...:||||.|||......|...|..:|..|:    ..|:...|.::....:.|..|..||  ||
 Worm    14 KTVFITGASRGIGKEIALKLAKDGANIVVAAKTATAHPKLPGTIYTAAAEIEKAGGHALPCVVDV 78

  Fly    66 SNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAIL--DVNVLGVTWCTRQWF 128
            .:|..|........:..||.|:|:|||..|   ::|:.|::...|..|  .:|..|....|:...
 Worm    79 RDEAAVKAAVDAAVKKFGGIDILINNASAI---SLTNTEDTDMKRYDLMHSINTRGTYLLTKTCL 140

  Fly   129 LSLQRRKVNDGHVVVINSV-----------VGHSVPAVEGFSLNM-----------YAPSKHAIT 171
            ..|::.|  :.||:.|:..           ||:::..   |.::|           |..:.:|:.
 Worm   141 PYLKKGK--NPHVLNISPPLDMEAKWFGPHVGYTMAK---FGMSMCVLGHHEEFRPYGIAVNALW 200

  Fly   172 ALTEI--LRQEFIKKG 185
            .||.|  ...||:..|
 Worm   201 PLTAIWTSAMEFLSHG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 53/211 (25%)
NADB_Rossmann 1..245 CDD:304358 53/211 (25%)
dhs-18NP_505812.1 PRK08278 11..279 CDD:181349 53/211 (25%)
adh_short 14..201 CDD:278532 47/194 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156027
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.