Sequence 1: | NP_001287440.1 | Gene: | CG3301 / 42528 | FlyBaseID: | FBgn0038878 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_505812.1 | Gene: | dhs-18 / 179529 | WormBaseID: | WBGene00000981 | Length: | 293 | Species: | Caenorhabditis elegans |
Alignment Length: | 211 | Identity: | 53/211 - (25%) |
---|---|---|---|
Similarity: | 86/211 - (40%) | Gaps: | 40/211 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 RVAVVTGASAGIGAACCRDLVAKGMVVVGLAR----REKVLQDIKSSLPADQAARFHTRPC--DV 65
Fly 66 SNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAIL--DVNVLGVTWCTRQWF 128
Fly 129 LSLQRRKVNDGHVVVINSV-----------VGHSVPAVEGFSLNM-----------YAPSKHAIT 171
Fly 172 ALTEI--LRQEFIKKG 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3301 | NP_001287440.1 | YdfG | 1..250 | CDD:226674 | 53/211 (25%) |
NADB_Rossmann | 1..245 | CDD:304358 | 53/211 (25%) | ||
dhs-18 | NP_505812.1 | PRK08278 | 11..279 | CDD:181349 | 53/211 (25%) |
adh_short | 14..201 | CDD:278532 | 47/194 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160156027 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |