DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and H04M03.3

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_500885.1 Gene:H04M03.3 / 177359 WormBaseID:WBGene00019153 Length:333 Species:Caenorhabditis elegans


Alignment Length:251 Identity:55/251 - (21%)
Similarity:92/251 - (36%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LNRVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARFHTRP----CDV 65
            ::|| ::||.:.|||......|.|:...:....|.....:|:....    ..:|:..|    .|:
 Worm    49 MSRV-LITGGTDGIGREAALKLAAEQHEITISGRDPNKAKDVIGQC----QMKFNNTPRFIQTDL 108

  Fly    66 SNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAILDVNVLGVTWCTRQWFLS 130
            |.|.:||...:.:...  ..|:.:.|||:   ||........|..|.:..|::. ::......:.
 Worm   109 SLEHEVIKFASQVAEE--QFDICILNAGV---MNPKPGRTREDREATMMTNLVS-SYMIAHKIID 167

  Fly   131 LQRRKVNDGHVVVINSVV--GHS---------------------VPA-VEGFSLNMYAPSKHAIT 171
            .:|......|.|...|::  .|:                     ||. |.|  ...||.||..:.
 Worm   168 SRRDDQRSLHFVFSTSILVKFHNATPLGIRFFNPEKVTDWQKSLVPTDVSG--AGKYAISKIGLA 230

  Fly   172 ALTEILRQEFIKKGTQTKITSISPGVVATEIFEAGSWEQPTGMPMLR--SEDIADA 225
            .|:..:.|..:...|   .||:.||.|.|.|.......|...:.:.|  :..:|||
 Worm   231 TLSTSISQCNLPNIT---ATSVHPGTVYTNIMSNLPARQQFYIKLARPFTTSLADA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 55/251 (22%)
NADB_Rossmann 1..245 CDD:304358 55/251 (22%)
H04M03.3NP_500885.1 NADB_Rossmann 51..294 CDD:304358 55/249 (22%)
adh_short 52..264 CDD:278532 49/227 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.