DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3301 and T25G12.13

DIOPT Version :9

Sequence 1:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001257285.1 Gene:T25G12.13 / 13224720 WormBaseID:WBGene00219274 Length:310 Species:Caenorhabditis elegans


Alignment Length:242 Identity:63/242 - (26%)
Similarity:103/242 - (42%) Gaps:40/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NRVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSL----PADQAARFHTRPC--- 63
            |::.|:||||:|:|.:...:|..:|..|:.|||..:.|::|.:.|    |.::     .:|.   
 Worm    46 NKIVVITGASSGLGKSLAFELYKRGAQVILLARSTEKLKEICAELTKTFPLNK-----NKPTYYF 105

  Fly    64 -DVSNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAILDVNVLGVTWCTRQW 127
             |::|.    |...|..  :...|||:||||:..:.:..| ...|..|..::.|:.|....|:  
 Worm   106 FDITNP----DKAPWAQ--IPKVDVLINNAGMSNRGSCQD-TTMAIHRKAMETNLFGHVQVTQ-- 161

  Fly   128 FLSLQRRKVNDGHVVVINSVVGHSVPAVEGFSLNMYAPSKHAITALTEILRQE------------ 180
              ||..:...||.:||.:|:.|.......|    .|:.||||:....:.||.|            
 Worm   162 --SLLSKLSPDGCIVVTSSIQGKVAIPYRG----SYSASKHALQGYFDCLRAEHKNLHILVVSAG 220

  Fly   181 FIKKGTQTKITSISPGVVATEIFEAGSWEQPTGMPMLRSEDIADAVT 227
            :|..|..::.......||..|.........|.....:.|:.|.|.|:
 Worm   221 YINTGFGSRALDTDGKVVGVEDENQKKGYSPEHSARMISDAIRDRVS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 63/242 (26%)
NADB_Rossmann 1..245 CDD:304358 63/242 (26%)
T25G12.13NP_001257285.1 NADB_Rossmann 44..290 CDD:304358 63/242 (26%)
PRK06181 46..289 CDD:235726 63/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.