DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and YMR262W

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_013989.2 Gene:YMR262W / 855304 SGDID:S000004875 Length:313 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:51/205 - (24%)
Similarity:82/205 - (40%) Gaps:58/205 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 IVEEPATWFDLEHIAQAQ----ECVAIGPCGLDYQRDFSEP--------------------DAQK 146
            ::.||   .|||...:.:    ....||..|||  :.|..|                    ..|:
Yeast   101 VLPEP---LDLEEYIKREFNDTLVSVIGEIGLD--KLFRLPANGFYMQNEKARLTTVKVKLSHQE 160

  Fly   147 QIFAKQLHLAIRLNKPLLIHERSAQLDLLEILDKFENL-----PPVIIRGFMGTAEEAL-----K 201
            .:|.:...||...:||:.||:......|.:|.:  |.|     ..:.:..:.|:.|..|     |
Yeast   161 TVFRRFCRLARHTSKPISIHDVKCHGKLNDICN--EELLTYHSVKICLHSYTGSKETLLGQWLKK 223

  Fly   202 YLDRRFYISLTGYL-CKD--KSDTGVRRLLEDGTLPLDRLLVETDAPFMYPNTRASKLPQHVKTG 263
            :...|.::||:.:: .||  :.|..||      :||...:|.|||.|...|:      |.:.| .
Yeast   224 FPPDRIFVSLSKWINFKDPEEGDALVR------SLPSTCILTETDYPIDNPD------PSYQK-A 275

  Fly   264 ITERSLLYLH 273
            :||: |.||:
Yeast   276 LTEQ-LQYLN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 51/205 (25%)
YMR262WNP_013989.2 TatD_DNase 5..313 CDD:395813 51/205 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.