DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and AT3G52390

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_974418.1 Gene:AT3G52390 / 824404 AraportID:AT3G52390 Length:323 Species:Arabidopsis thaliana


Alignment Length:285 Identity:83/285 - (29%)
Similarity:136/285 - (47%) Gaps:40/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DVGANLTNKKYS----------RDLDSVVQRARDAGVQKLMVHGTSVKSSKEALRLSRIYPDIIY 93
            |:..|.|:..:.          .|:.:|:.||..|||.:::|.|.|::.|:|||.::.. ...::
plant    11 DIAVNFTDGMFKGLYHGKNCHVPDIATVLNRAWSAGVDRIIVTGGSLEESREALAIAET-DGRLF 74

  Fly    94 STAGIHPHDSKSIVE--EPATWFD-LEHIA----QAQECVAIGPCGLDYQR-DFSEPDAQKQIFA 150
            .|.|:||.......|  :|...:. |..:|    |..:.||||.|||||.| .|...|.||:.|.
plant    75 CTVGVHPTRCNEFEESGDPEKHYQALFSLAKEGMQKGKVVAIGECGLDYDRLQFCSVDIQKKYFE 139

  Fly   151 KQLHLAIRLNKPLLIHERSAQLDLLEILDKFEN-LPPVIIRGFMGTAEEALKYLD-RRFYISLTG 213
            ||..||.....|:.:|.|:|..|..||:::.:| ....:...|.|:|.:..|.|. .:.|:.:.|
plant   140 KQFELAYATKLPMFLHMRAAAEDFCEIVERNKNRFTGGVAHSFTGSASDRDKLLSFDKMYLGVNG 204

  Fly   214 YLCKDKSDTGVRRLLEDGTLPLDRLLVETDAPFM-YPNTRA------SKLPQHVKTGITERSLLY 271
            ...|...:..|.:     .:|::|:::|||:|:. ..||.|      |..|...|....:.||:.
plant   205 CSLKTAENLEVMK-----GIPVERMMIETDSPYCDIKNTHAGIKFVKSTWPSKKKEKYDQESLVK 264

  Fly   272 LHRYCTFQRNEPCSLPAIVEMIAAF 296
                   .|||||.:..::|::|.:
plant   265 -------GRNEPCLVRQVLEVVAGY 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 83/285 (29%)
AT3G52390NP_974418.1 TatD_DNAse 11..304 CDD:238635 83/285 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1224437at2759
OrthoFinder 1 1.000 - - FOG0003172
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100330
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2566
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.