DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and Tatdn3

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_081171.1 Gene:Tatdn3 / 68972 MGIID:1916222 Length:294 Species:Mus musculus


Alignment Length:291 Identity:80/291 - (27%)
Similarity:129/291 - (44%) Gaps:44/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIDVGANLTNKKYSRDLDSVVQRARDAGVQKLMVHGTSVKSSKEALRLSRIYPDIIYSTAGIHPH 101
            ::|...:|:...:..|||.|:::||.|.|..|:.........:..::||..|...:....|:||.
Mouse     5 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVAEHAGEFERIMQLSERYNGFVLPCLGVHPV 69

  Fly   102 DSKSIVEEP--ATWFDLEHIAQAQE-----CVAIGPCGLDYQRDFS----EPDAQKQIFAKQLHL 155
            ...| .|:|  .|..||:......|     .:|||..|||:...::    |.:.|:|:..:|:.|
Mouse    70 QELS-PEKPRSVTLKDLDVALPIIEKYKDRLLAIGEVGLDFTPRYAGTDEEKEEQRQVLIRQVQL 133

  Fly   156 AIRLNKPLLIHERSAQLDLLEILDKFENLPPVIIRGFMGTAEEALKYLDRRFYISLTGYLCKDKS 220
            |.|||.||.:|.|||....:.:| :.:....|::..|.|....|::.....:|.|:...:.:   
Mouse   134 AKRLNVPLNVHSRSAGRPTISLL-REQGAKQVLLHAFDGRPSVAMEGARAGYYFSIPPSIVR--- 194

  Fly   221 DTGVRRLLEDGTLPLDRLLVETDAPFMYPNTRASKLPQHVKTGITERSLLYLHRYCTFQRNEPCS 285
             :|.::.|.. .|||..:.:|||:|.:.|    .||                      .|||||:
Mouse   195 -SGQKQKLVK-QLPLSSICLETDSPALGP----EKL----------------------TRNEPCN 231

  Fly   286 LPAIVEMIAAFMKKSPDEVALATAFNALKLF 316
            :....|.||.....|.:||...|..||.:||
Mouse   232 ISIAAEFIAQVKGISVEEVREVTTRNAFRLF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 80/290 (28%)
Tatdn3NP_081171.1 TatD_DNAse 5..262 CDD:238635 78/289 (27%)
COG1099 6..262 CDD:224024 78/288 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100330
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.