DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and tatdn2

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001122165.1 Gene:tatdn2 / 557931 ZFINID:ZDB-GENE-081022-51 Length:678 Species:Danio rerio


Alignment Length:235 Identity:62/235 - (26%)
Similarity:104/235 - (44%) Gaps:43/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SSKEALRLSRIYPDIIYSTAGIHPHDSKSIVE--EPATWFDLEHIAQAQECVAIGPCGLDY-QRD 138
            :.:||:....:..:.::...|.|||.:|...:  |.:....:.|    .:.:|.|..|||| .::
Zfish   459 TQREAIWEGLLGEEKVWGAFGCHPHFAKEYNQNHEQSIMSAMRH----PKAIAFGEIGLDYSHKN 519

  Fly   139 FSEPDAQKQIFAKQLHLAIRLNKPLLIHERSAQLDLLEILDK------------FENLPPVIIRG 191
            .::...||::|.:||.|.:.|.|||:||.|.|..|:|.|:.|            |.|...||   
Zfish   520 STDSRKQKEVFERQLQLGVALRKPLVIHCRDADDDVLTIMKKCVPRDYKIHRHCFTNSYSVI--- 581

  Fly   192 FMGTAEEALKYLDRRFYISLTG---YLCKDKSDTGVRRLLEDGTLPLDRLLVETDAPFMYPNTRA 253
                 |..||.. ....:..||   |....::...||:      :||:|:|:|||||:..|....
Zfish   582 -----EPFLKEF-TNLCVGFTGLVTYHRATEARDAVRK------IPLNRILLETDAPYFLPRQVP 634

  Fly   254 SKLPQHVKTGITERSLLYLHRYCTFQRNEPCSLPAIVEMI 293
            ..:.:....|:...:|    |..:..:.|  .||.:::.|
Zfish   635 KSICRFAHPGMGIHTL----REISLLKGE--LLPTVLQTI 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 62/235 (26%)
tatdn2NP_001122165.1 TatD_DNase 412..677 CDD:279378 62/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1963
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.