DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and Tatdn2

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001102722.1 Gene:Tatdn2 / 500295 RGDID:1586017 Length:773 Species:Rattus norvegicus


Alignment Length:236 Identity:70/236 - (29%)
Similarity:100/236 - (42%) Gaps:36/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DIIYSTAGIHPHDSKSIVEEPATWFDLEHIAQAQECVAIGPCGLDYQRDFSEP-DAQKQIFAKQL 153
            |:::...|.|||.::...|....  .|.|..:..:.||.|..||||....:.| ..|.|:|.:||
  Rat   567 DLVWGAFGCHPHFARYYNESQER--KLLHALRHPKAVAFGEMGLDYSHKCTTPVPEQHQVFERQL 629

  Fly   154 HLAIRLNKPLLIHERSAQLDLLEILDKFENLPPVIIR----GFMGTAEEALKYLDRRF--YISLT 212
            .||:.|.|||:||.|.|..|||:|:.||......|.|    |.....|..|||.....  :.::.
  Rat   630 QLAVSLKKPLVIHCREADEDLLDIMKKFVPSDYKIHRHCFTGSYSVIEPLLKYFPNMSVGFTAVV 694

  Fly   213 GYLCKDKSDTGVRRLLEDGTLPLDRLLVETDAPFMYPNTRASKLPQHVKTGITERSLLYLHRYCT 277
            .|....|:...:|:      :||:|::||||||:..|......|.|:...|      |.||    
  Rat   695 TYSSAWKARDAIRQ------IPLERIIVETDAPYFLPRQVPRSLCQYAHPG------LALH---- 743

  Fly   278 FQRNEPCSLPAIVEMIAAFMKKSPDEVALATAFNALKLFGL 318
                       .|..||...::|..........|..:|:.|
  Rat   744 -----------TVREIARVKEESLSHTLSVLRENTSRLYSL 773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 69/233 (30%)
Tatdn2NP_001102722.1 COG1099 507..773 CDD:224024 69/234 (29%)
TatD_DNase 508..772 CDD:279378 69/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.