DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and Tatdn2

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001334285.1 Gene:Tatdn2 / 381801 MGIID:3576210 Length:783 Species:Mus musculus


Alignment Length:237 Identity:72/237 - (30%)
Similarity:100/237 - (42%) Gaps:38/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DIIYSTAGIHPHDSKSIVEEPATWFDLEHIAQAQECVAIGPCGLDYQRDFSEP-DAQKQIFAKQL 153
            |:::...|.|||.::...|....  .|.|..:..:.||.|..||||....:.| ..|.|:|.:||
Mouse   577 DLVWGAFGCHPHFARYYNESQER--KLLHALRHPKAVAFGEMGLDYSHKCTTPVPEQHQVFERQL 639

  Fly   154 HLAIRLNKPLLIHERSAQLDLLEILDKFENLPPVIIR----GFMGTAEEALKYLDRR---FYISL 211
            .||:.|.|||:||.|.|..|||:|:.||......|.|    |.....|..|||....   |...|
Mouse   640 KLAVSLKKPLVIHCREADEDLLDIMRKFVPSDYKIHRHCFTGSYSVIEPLLKYFPNMSVGFTAVL 704

  Fly   212 TGYLCKDKSDTGVRRLLEDGTLPLDRLLVETDAPFMYPNTRASKLPQHVKTGITERSLLYLHRYC 276
            | |....::...:|:      :||:|::||||||:..|......|.|:...|      |.||   
Mouse   705 T-YSSAWEARDALRQ------IPLERIIVETDAPYFLPRQVPRSLCQYAHPG------LALH--- 753

  Fly   277 TFQRNEPCSLPAIVEMIAAFMKKSPDEVALATAFNALKLFGL 318
                        .|..||...::|..........|..:|:.|
Mouse   754 ------------TVREIARVKEESLSHTLSVLRENTCRLYSL 783

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 71/234 (30%)
Tatdn2NP_001334285.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4215
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1963
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.750

Return to query results.
Submit another query.