DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and CG3358

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001246156.2 Gene:CG3358 / 35604 FlyBaseID:FBgn0033117 Length:291 Species:Drosophila melanogaster


Alignment Length:293 Identity:94/293 - (32%)
Similarity:137/293 - (46%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KKYSRDLDSVVQRARDAGVQKLMVHGTSVKSSKEALRLSRIYPDIIYSTAGIHPHDSKSIVEEPA 111
            :|:..||..|::||...|:||::|....:|...|||.|:. ..:.||:|.|.||...:..|.:|.
  Fly    10 QKHEPDLHIVLERAWQQGLQKVIVTAGCLKDVDEALELAS-KDERIYTTVGTHPTRCEEFVPDPE 73

  Fly   112 TWFDLEHI---AQAQECVAIGPCGLDYQR-DFSEPDAQKQIFAKQLHLAIRLNKPLLIHERSAQL 172
            .::|....   |...:..|:|.|||||.| .|...:.|:..|.|||.||.....||.:|.|:|..
  Fly    74 GYYDQLRSRIKANRTKVRAVGECGLDYDRLHFCAQETQRLYFEKQLDLAAEFKLPLFLHMRNAAE 138

  Fly   173 DLLEILD----KFENLPPVIIRGFMGTAEEALKYLD-RRFYISLTGYLCKDKSDTG---VRRLLE 229
            |.:.||:    |.|.....::..|.||.|||.:.|. ...||...|  |..|:|..   ||:   
  Fly   139 DFMGILERNRNKIEECGGGVVHSFTGTLEEAQRILAFGGLYIGFNG--CSLKTDENAEVVRK--- 198

  Fly   230 DGTLPLDRLLVETDAPF--MYPNTRASKLPQHVKTGI---------TERSLLYLHRYCTFQRNEP 283
               ||.||:::|||.|:  :.|:....|   ||.|..         |..||:       ..|.||
  Fly   199 ---LPNDRIMLETDCPWCGIRPSHAGHK---HVTTKFPTVKKKEKWTAESLI-------DGRCEP 250

  Fly   284 CSLPAIVEMIAAFMKKSPDEVALATAFNALKLF 316
            |.:..::|.||...::..:::|.....|.|.||
  Fly   251 CQISQVLESIAGIKQEPKEQLAALYYQNTLDLF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 94/293 (32%)
CG3358NP_001246156.2 TatD_DNAse 13..284 CDD:238635 93/290 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1224437at2759
OrthoFinder 1 1.000 - - FOG0003172
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100330
Panther 1 1.100 - - P PTHR10060
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1963
SonicParanoid 1 1.000 - - X2566
87.880

Return to query results.
Submit another query.