DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and Tatdn3

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_038946526.1 Gene:Tatdn3 / 289378 RGDID:1589779 Length:315 Species:Rattus norvegicus


Alignment Length:330 Identity:90/330 - (27%)
Similarity:143/330 - (43%) Gaps:64/330 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PSQQTPQETVVAPVAPLLEDQLELDMKHCFENLIVIDVGANLTNKKYSRDLDSVVQRARDAGVQK 67
            |....||.:.:.||    |....:.|     .|.::|...:|:...:..|||.|:::||.|.|..
  Rat    25 PRLPRPQSSALVPV----EKPSGVAM-----GLGLVDCHCHLSAPDFDSDLDDVLEKARKANVMA 80

  Fly    68 LMVHGTSVKSSKEALRLSRIYPDIIYSTAGIHPHDSKSIVEE-------PATWFDLEHIAQAQE- 124
            |:.........::.::||..|...|....|:||      |:|       ..|..||:......| 
  Rat    81 LVAVAEHAGEFEKIMQLSERYNGFILPCLGVHP------VQELSPEKTRSVTLKDLDVALPIVEN 139

  Fly   125 ----CVAIGPCGLDYQRDFS----EPDAQKQIFAKQLHLAIRLNKPLLIHERSAQLDLLEILDKF 181
                .:|||..|||:...::    |.:.|:|:..:|:.||.|||.||.:|.|||....:.:| :.
  Rat   140 YKDRLLAIGEVGLDFSPRYAGTHEEKEEQRQVLIRQVQLAKRLNVPLNVHSRSAGRPTISLL-RE 203

  Fly   182 ENLPPVIIRGFMGTAEEALKYLDRRFYISLTGYLCKDKSDTGVRRLLEDGTLPLDRLLVETDAPF 246
            :....|::..|.|....|::.:...:|.|:...:.:    :|.::|::.  |||..|.:|||:|.
  Rat   204 QGAEKVLLHAFDGRPSVAMEGVRAGYYFSIPPSIVR----SGQQKLVKQ--LPLSSLCLETDSPA 262

  Fly   247 MYPNTRASKLPQHVKTGITERSLLYLHRYCTFQRNEPCSLPAIVEMIAAFMKKSPDEVALATAFN 311
            :.|    .||                      .|||||::....|.||.....|.:||...|..|
  Rat   263 LGP----EKL----------------------TRNEPCNISIAAEFIAQVKGISVEEVREVTTQN 301

  Fly   312 ALKLF 316
            |.|||
  Rat   302 AFKLF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 82/295 (28%)
Tatdn3XP_038946526.1 TatD_DNAse 50..306 CDD:238635 80/294 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D409357at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100330
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.