DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and Y37H2A.1

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001256781.1 Gene:Y37H2A.1 / 180186 WormBaseID:WBGene00012562 Length:477 Species:Caenorhabditis elegans


Alignment Length:247 Identity:76/247 - (30%)
Similarity:107/247 - (43%) Gaps:42/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SRIYPDIIYSTAGIHPHDSKSIVEEPATWFDLEHI---AQAQECVAIGPCGLDYQRDFSEPDAQK 146
            |.||   :.:|.|.|||.::....:...|..||||   |...:.:|:|.||||..|..|:.:.||
 Worm   253 SNIY---LGTTWGCHPHYAQEWASKDIFWQTLEHILSNAATWKVLAVGECGLDLHRCISDLEVQK 314

  Fly   147 QIFAKQLHLAIRLNKPLLIHERS-----AQLDLLEILDK--FENLPPVIIRG--FMGTAEEALKY 202
            .:|.|.:.||.:...||:||.||     |:...|.||.|  .||...:.|..  |..|.|.|..:
 Worm   315 MVFEKHIDLAYKYQLPLVIHCRSGQKGRAEEQCLRILKKKMDENHKFLKIHRHCFTETWEVAQMW 379

  Fly   203 LDR--RFYISLTGYLCKDKSDTGVRRLLED-GTLPLDRLLVETDAPFMYPNTRASKLPQHVKTGI 264
            :.:  ..|...|..:.|.:.    |:.||. ..:||:|:|:|||||:..|.......|::|    
 Worm   380 MKQCPNVYFGYTAAIFKMRE----RQQLEAIRHIPLNRILLETDAPYFRPPCFEGVGPRNV---- 436

  Fly   265 TERSLLYLHRYCTFQRNEPCSLPAIVEMIAAFMKKSPDEVALATAFNALKLF 316
                       |.     |....|....||...:...|||..||..|...|:
 Worm   437 -----------CL-----PGMAIATARKIAEIKELPVDEVLRATFDNTRLLY 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 76/247 (31%)
Y37H2A.1NP_001256781.1 TatD_DNase 177..473 CDD:279378 76/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1963
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.