DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and TATDN3

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001139643.1 Gene:TATDN3 / 128387 HGNCID:27010 Length:281 Species:Homo sapiens


Alignment Length:303 Identity:78/303 - (25%)
Similarity:131/303 - (43%) Gaps:61/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIDVGANLTNKKYSRDLDSVVQRARDAGVQKLMVHGTSVKSSKEALRLSRIYPDIIYSTAGIH-- 99
            ::|...:|:...:.||||.|:::|:.|.|..|:.........::.::||..|...:....|:|  
Human     8 LVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCLGVHPV 72

  Fly   100 ----PHDSKSIVEEPATWFDLEHIAQAQE-----CVAIGPCGLDYQRDFS----EPDAQKQIFAK 151
                |.|.:|:     |..||:......|     .:|||..|||:...|:    :.:.|:|:..:
Human    73 QGLPPEDQRSV-----TLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQRQVLIR 132

  Fly   152 QLHLAIRLNKPLLIHERSAQLDLLEILDKFENLPPVIIRGFMGTAEEALKYLDRRFYISL----- 211
            |:.||.|||.|:.:|.|||....:.:|.: :....|::..|.|....|::.:...::.|:     
Human   133 QIQLAKRLNLPVNVHSRSAGRPTINLLQE-QGAEKVLLHAFDGRPSVAMEGVRAGYFFSIPPSII 196

  Fly   212 -TGYLCK--DKSDTGVRRLLEDGTLPLDRLLVETDAPFMYPNTRASKLPQHVKTGITERSLLYLH 273
             :|.|..  .|....|::      |||..:.:|||:|.:.|..:.                    
Human   197 RSGQLLSLFSKKQKLVKQ------LPLTSICLETDSPALGPEKQV-------------------- 235

  Fly   274 RYCTFQRNEPCSLPAIVEMIAAFMKKSPDEVALATAFNALKLF 316
                  ||||.::....|.||.....|.:||...|..||||||
Human   236 ------RNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 78/302 (26%)
TATDN3NP_001139643.1 TatD_DNase 9..272 CDD:279378 76/300 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D409357at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100330
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.