DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and tatdn1

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_002938706.1 Gene:tatdn1 / 100496747 XenbaseID:XB-GENE-945962 Length:297 Species:Xenopus tropicalis


Alignment Length:301 Identity:93/301 - (30%)
Similarity:156/301 - (51%) Gaps:36/301 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IDVGANLTN----------KKYSRDLDSVVQRARDAGVQKLMVHGTSVKSSKEALRLSRIYPDII 92
            ||:|.|||:          :|:..|...:::||..|||||.|:.|.::..||||::|:: ..|..
 Frog     7 IDIGINLTDPMFRGLYRGTRKHQDDFADIIERAVRAGVQKFMITGGNLHESKEAIQLAQ-SNDHF 70

  Fly    93 YSTAGIHPHDSKSIVE-EPATWFDLEHIAQAQE--------CVAIGPCGLDYQR-DFSEPDAQKQ 147
            |||.|.||.......: :|.     :::|:.|:        .||:|.||||:.| :|...:.|.:
 Frog    71 YSTVGCHPTRCGEFEQGDPE-----QYLAELQDLLENNKGKVVAVGECGLDFDRLEFCPKETQLK 130

  Fly   148 IFAKQLHLAIRLNKPLLIHERSAQLDLLEILDK-FENLPPVIIRGFMGTAEEALKYLDRRFYISL 211
            .|.||..||.|...|:.:|.|:|..:.|:|:.: .:.....::..|.||.|:|...:....||.:
 Frog   131 YFEKQFELAERSRLPMFLHCRNAHTEFLDIMQRNRDRCVGGVVHSFDGTKEDAEAIIGLDLYIGI 195

  Fly   212 TGYLCKDKSDTGVRRLLEDGTLPLDRLLVETDAPFM-YPNTRASKLPQHVKTGITERSLLYLHRY 275
            .|...|..|:..|.:     ::|.:||::|||||:. ..||.|..  :.|||....:. .:...|
 Frog   196 NGCSLKTASNLEVLK-----SIPSERLMIETDAPWCGVKNTHAGS--KFVKTTFPTKK-KWEAGY 252

  Fly   276 CTFQRNEPCSLPAIVEMIAAFMKKSPDEVALATAFNALKLF 316
            |...|||||::..::|::|:..::.|.|::.....|.:|:|
 Frog   253 CLKDRNEPCNIIQVLEIMASAREEDPSELSKTLYNNTVKVF 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 93/301 (31%)
tatdn1XP_002938706.1 TatD_DNAse 6..294 CDD:238635 93/301 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1224437at2759
OrthoFinder 1 1.000 - - FOG0003172
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2566
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.