DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and tatdn3

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_012819400.1 Gene:tatdn3 / 100380120 XenbaseID:XB-GENE-5839532 Length:273 Species:Xenopus tropicalis


Alignment Length:292 Identity:77/292 - (26%)
Similarity:137/292 - (46%) Gaps:44/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVIDVGANLTNKKYSRDLDSVVQRARDAGVQKLMVHGTSVKSSKEALRLSRIYPDIIYSTAGIHP 100
            :::|...:|:...:..|:|.|::.::..|:..|:.........::.::|||.:..:::...|:||
 Frog     6 VLVDCHCHLSASDFDHDIDKVLEESKTIGLCALVAVAEHSGEFEKVIQLSRSHVGLVFPCLGVHP 70

  Fly   101 -HDSKSIVEEPATWFDLEH----IAQ-AQECVAIGPCGLDYQRDFS----EPDAQKQIFAKQLHL 155
             ..|.:..:..||..|:|.    |.| ..|.||||..|||:....:    :.:.|:|:|.:|:.|
 Frog    71 VQGSATGPQRSATLQDVEDALPMIEQYRDELVAIGEVGLDFTPRIACTDDQKEEQRQVFIRQIEL 135

  Fly   156 AIRLNKPLLIHERSAQLDLLEIL-DKFENLPPVIIRGFMGTAEEALKYLDRRFYISLTGYLCKDK 219
            |.|||.||.:|.|||....:.:| ||  ....|::..|.|....|::.:...:|.|:...:.:.:
 Frog   136 AKRLNLPLNVHSRSAGRPTISLLRDK--GAEKVLLHAFDGKPSVAMEGVKAGYYFSIPPSIIRSE 198

  Fly   220 SDTGVRRLLEDGTLPLDRLLVETDAPFMYPNTRASKLPQHVKTGITERSLLYLHRYCTFQRNEPC 284
            ..   ::|::.  |||:.:.:|||:|.:.|..:.                          ||||.
 Frog   199 QK---QKLVKQ--LPLENMCLETDSPALGPEKQV--------------------------RNEPK 232

  Fly   285 SLPAIVEMIAAFMKKSPDEVALATAFNALKLF 316
            ::....|.||.....|.:||...|..||||:|
 Frog   233 NILHSAEYIARVKGISLEEVIEITTKNALKVF 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 77/290 (27%)
tatdn3XP_012819400.1 TatD_DNAse 7..264 CDD:238635 76/289 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D409357at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.