DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3308 and tatdn1

DIOPT Version :9

Sequence 1:NP_650963.2 Gene:CG3308 / 42527 FlyBaseID:FBgn0038877 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001002213.1 Gene:tatdn1 / 100151626 ZFINID:ZDB-GENE-040704-56 Length:298 Species:Danio rerio


Alignment Length:297 Identity:90/297 - (30%)
Similarity:152/297 - (51%) Gaps:31/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NLIVIDVGANLTN----------KKYSRDLDSVVQRARDAGVQKLMVHGTSVKSSKEALRLSRIY 88
            |...||:|.|||:          :|:..|...||:||...||||.::.|.:::.|:.||.|:.. 
Zfish     3 NFRFIDIGINLTDPMFRGVYRGTQKHEDDFAEVVERALQVGVQKFIITGGNLEDSRAALTLTHT- 66

  Fly    89 PDIIYSTAGIHP-----HDSKSIVEEPATWFDLEHIAQAQECVAIGPCGLDYQR-DFSEPDAQKQ 147
            .:..:||.|.||     .|.:...:..::..||. ::..|:.||:|.||||:.| :|...:.|.:
Zfish    67 REQFFSTVGCHPTRCSEFDDQGSDQYLSSLLDLT-VSNTQKVVAVGECGLDFDRLEFCPKETQLR 130

  Fly   148 IFAKQLHLAIRLNKPLLIHERSAQLDLLEILDK-FENLPPVIIRGFMGTAEEALKYLDRRFYISL 211
            .|..|..||.....|:.:|.|:|..:.::|:.: .:.....::..|.|:.::|...||...||.:
Zfish   131 YFQLQFDLAEASGLPMFLHCRNAHTEFIDIMRRNRQRCVGGVVHSFDGSQQDAAALLDLDLYIGI 195

  Fly   212 TGYLCKDKSDTGVRRLLEDGTLPLDRLLVETDAPFM-YPNTRA-SKLPQHVKTGITERSLLYLHR 274
            .|...|...:..|.:     ::|.|||::|||||:. ..||.| :||   :||....:. .:...
Zfish   196 NGCSLKTAENLEVMK-----SIPSDRLMIETDAPWCGIKNTHAGAKL---IKTSFPTKK-KWETG 251

  Fly   275 YCTFQRNEPCSLPAIVEMIAAFMKKSPDEVALATAFN 311
            :|...|||||.:..::|::||..::.|.::| .|.||
Zfish   252 HCVKDRNEPCHIIQVLEVMAAVREEDPLDLA-ETIFN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3308NP_650963.2 TatD_DNAse 38..317 CDD:238635 89/293 (30%)
tatdn1NP_001002213.1 TatD_DNAse 6..294 CDD:238635 89/294 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1224437at2759
OrthoFinder 1 1.000 - - FOG0003172
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100330
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1963
SonicParanoid 1 1.000 - - X2566
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.