DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idi and IDI2

DIOPT Version :9

Sequence 1:NP_001163673.1 Gene:Idi / 42526 FlyBaseID:FBgn0038876 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_150286.1 Gene:IDI2 / 91734 HGNCID:23487 Length:227 Species:Homo sapiens


Alignment Length:219 Identity:92/219 - (42%)
Similarity:137/219 - (62%) Gaps:5/219 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DPLQAHALKEQCILVDANDQAIGAASKADCHRVHPETNDVKLHRAFSVFLFNSQGEMLVQKRSSH 104
            |..|...|:|..|:||.||:.|||.:|.:|| ::.......|||||||.|||::..:|:|:||..
Human    10 DRRQLQRLEEMLIVVDENDKVIGADTKRNCH-LNENIEKGLLHRAFSVVLFNTKNRILIQQRSDT 73

  Fly   105 KITFPNTYTNACCSHPLYEIEQERQERNAQGIRVAAQRRLNYELGIPTEELQPQDFRYLTRIHYA 169
            |:|||..:|::|.|||||. ..|.:|::|.|:|.||||||..|||||.|::.|:|..::|..|:.
Human    74 KVTFPGYFTDSCSSHPLYN-PAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHK 137

  Fly   170 DTGDGVWGEHEIDYILFLQKDVTLRPNSNEVSEVRYLRRDKIDEAV---AKFSAPLTPWFSLILQ 231
            ...|.:||||||.|:|.::|:|||.|:.:|...:.||.::::.|.:   |:....:|||...|.:
Human   138 AKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELWELLEREARGEVKVTPWLRTIAE 202

  Fly   232 HRLKLWWDNLHQLEQFEDLSNIQR 255
            ..|..||.:|..:..|.:|..|.|
Human   203 RFLYRWWPHLDDVTPFVELHKIHR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IdiNP_001163673.1 Nudix_Hydrolase 48..256 CDD:294304 89/211 (42%)
Idi 49..233 CDD:224360 81/186 (44%)
IDI2NP_150286.1 Nudix_Hydrolase 6..227 CDD:320976 92/219 (42%)
Microbody targeting signal. /evidence=ECO:0000255 225..227 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159889
Domainoid 1 1.000 169 1.000 Domainoid score I3809
eggNOG 1 0.900 - - E1_COG1443
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3581
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54285
OrthoDB 1 1.010 - - D1281908at2759
OrthoFinder 1 1.000 - - FOG0001381
OrthoInspector 1 1.000 - - otm41265
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10885
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.