DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idi and IPP1

DIOPT Version :9

Sequence 1:NP_001163673.1 Gene:Idi / 42526 FlyBaseID:FBgn0038876 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_197148.3 Gene:IPP1 / 831505 AraportID:AT5G16440 Length:291 Species:Arabidopsis thaliana


Alignment Length:224 Identity:99/224 - (44%)
Similarity:146/224 - (65%) Gaps:9/224 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DPLQAHAL-KEQCILVDANDQAIGAASKADCHRVHPETNDVKLHRAFSVFLFNSQGEMLVQKRSS 103
            |.:|...: :::|||||.||:.:|..:|.:||.:.....:..||||||||||||:.|:|:|:||.
plant    68 DAVQRRLMFEDECILVDENDRVVGHDTKYNCHLMEKIEAENLLHRAFSVFLFNSKYELLLQQRSK 132

  Fly   104 HKITFPNTYTNACCSHPLYEIEQERQERNAQGIRVAAQRRLNYELGIPTEELQPQDFRYLTRIHY 168
            .|:|||..:||.|||||||. |.|..|.|..|:|.||||:|..||||..|::...:|..|.|:.|
plant   133 TKVTFPLVWTNTCCSHPLYR-ESELIEENVLGVRNAAQRKLFDELGIVAEDVPVDEFTPLGRMLY 196

  Fly   169 ADTGDGVWGEHEIDYILFLQKDVTLRPNSNEVSEVRYLRRDKIDEAVAKFSA-----PLTPWFSL 228
            ....||.|||||:||:||:.:||.|:||.:||:|::|:.|:::.|.|.|..|     .|:|||.|
plant   197 KAPSDGKWGEHEVDYLLFIVRDVKLQPNPDEVAEIKYVSREELKELVKKADAGDEAVKLSPWFRL 261

  Fly   229 ILQHRLKLWWDNLHQ--LEQFEDLSNIQR 255
            ::.:.|..|||::.:  :.:..|:..|.:
plant   262 VVDNFLMKWWDHVEKGTITEAADMKTIHK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IdiNP_001163673.1 Nudix_Hydrolase 48..256 CDD:294304 97/215 (45%)
Idi 49..233 CDD:224360 91/188 (48%)
IPP1NP_197148.3 PLN02552 58..291 CDD:215303 99/224 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 158 1.000 Domainoid score I1298
eggNOG 1 0.900 - - E1_COG1443
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3315
Inparanoid 1 1.050 195 1.000 Inparanoid score I1348
OMA 1 1.010 - - QHG54285
OrthoDB 1 1.010 - - D1281908at2759
OrthoFinder 1 1.000 - - FOG0001381
OrthoInspector 1 1.000 - - otm2553
orthoMCL 1 0.900 - - OOG6_102471
Panther 1 1.100 - - O PTHR10885
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X870
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.