DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idi and RGD1564999

DIOPT Version :9

Sequence 1:NP_001163673.1 Gene:Idi / 42526 FlyBaseID:FBgn0038876 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038952303.1 Gene:RGD1564999 / 689872 RGDID:1564999 Length:227 Species:Rattus norvegicus


Alignment Length:248 Identity:97/248 - (39%)
Similarity:143/248 - (57%) Gaps:32/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VSWLRGCSTTAVGQKHQRQVPTEFAVHDPLQAHALKEQCILVDANDQAIGAASKADCHRVHPETN 77
            |.|:         .|||.|              .|.|..|:||.||:.|||.:|.:||:   ..|
  Rat     6 VDWI---------DKHQLQ--------------RLDEMLIVVDENDKVIGADTKRNCHQ---NKN 44

  Fly    78 DVK--LHRAFSVFLFNSQGEMLVQKRSSHKITFPNTYTNACCSHPLYEIEQERQERNAQGIRVAA 140
            ..|  |||||||.||||:.::|:|:|:..|:|||..||::|.||||...| |.:|::|.|::.||
  Rat    45 IEKGLLHRAFSVVLFNSEKKVLIQRRADTKLTFPGYYTDSCYSHPLSNPE-EMEEKDALGVKRAA 108

  Fly   141 QRRLNYELGIPTEELQPQDFRYLTRIHYADTGDGVWGEHEIDYILFLQKDVTLRPNSNEVSEVRY 205
            .|||..|||||.:::..:|..::.|.||....|.||||||:.|:|.::|||.:.|:.:|||...|
  Rat   109 LRRLQAELGIPQDQVSLEDIVFMKRYHYKAKSDAVWGEHEVCYLLLIKKDVKICPDPSEVSSFSY 173

  Fly   206 LRRDKIDEAV---AKFSAPLTPWFSLILQHRLKLWWDNLHQLEQFEDLSNIQR 255
            |.|::::|.:   |:....:|||...:::..|..||..|.:..:|.:|..|.|
  Rat   174 LTREELEELLERGARGEVQVTPWLRFVVEQFLYAWWPYLDEATRFIELDKIYR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IdiNP_001163673.1 Nudix_Hydrolase 48..256 CDD:294304 90/213 (42%)
Idi 49..233 CDD:224360 82/188 (44%)
RGD1564999XP_038952303.1 Nudix_Hydrolase 1..227 CDD:412381 97/248 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1281908at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.