DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idi and Idi2

DIOPT Version :9

Sequence 1:NP_001163673.1 Gene:Idi / 42526 FlyBaseID:FBgn0038876 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001178937.1 Gene:Idi2 / 502143 RGDID:1559783 Length:227 Species:Rattus norvegicus


Alignment Length:215 Identity:87/215 - (40%)
Similarity:132/215 - (61%) Gaps:5/215 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LQAHALKEQCILVDANDQAIGAASKADCHRVHPETNDVKLHRAFSVFLFNSQGEMLVQKRSSHKI 106
            ||...|:|..|::|..||.|||.:|.:||.:. ..|...|||.|||.|||:|.::|||:|:..|.
  Rat    12 LQIKRLEEILIVIDKQDQIIGADTKRNCHLME-NINKGLLHRGFSVVLFNTQNQLLVQQRADAKY 75

  Fly   107 TFPNTYTNACCSHPLYEIEQERQERNAQGIRVAAQRRLNYELGIPTEELQPQDFRYLTRIHYADT 171
            |||..:|::|.||||| :.:|.:|.:|.|:|.||.|||..|||||.:::..:|..::||.:....
  Rat    76 TFPGHFTDSCSSHPLY-VPEELEEEDALGVRRAALRRLQAELGIPQDQISIKDITFMTRKYQKCQ 139

  Fly   172 GDGVWGEHEIDYILFLQKDVTLRPNSNEVSEVRYLRRDKIDEAV---AKFSAPLTPWFSLILQHR 233
            .|.|||:|||.|:|.::||:||.|:..||....|:.::.:.|.:   |:.:..:||||..:::..
  Rat   140 SDAVWGDHEIGYLLLVRKDLTLNPDPREVRSYSYMSQEDVQELLDREARGAEKITPWFRSMVEDF 204

  Fly   234 LKLWWDNLHQLEQFEDLSNI 253
            |..||..|..:..|.:...|
  Rat   205 LLPWWPYLEDVSPFVEPDKI 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IdiNP_001163673.1 Nudix_Hydrolase 48..256 CDD:294304 84/209 (40%)
Idi 49..233 CDD:224360 78/186 (42%)
Idi2NP_001178937.1 Nudix_Hydrolase 18..227 CDD:294304 84/209 (40%)
Idi 18..222 CDD:224360 83/205 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1281908at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.