DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idi and RGD1564347

DIOPT Version :9

Sequence 1:NP_001163673.1 Gene:Idi / 42526 FlyBaseID:FBgn0038876 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038952385.1 Gene:RGD1564347 / 364764 RGDID:1564347 Length:227 Species:Rattus norvegicus


Alignment Length:221 Identity:93/221 - (42%)
Similarity:139/221 - (62%) Gaps:9/221 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DPLQAHALKEQCILVDANDQAIGAASKADCHRVHPETNDVK--LHRAFSVFLFNSQGEMLVQKRS 102
            |..|...|.|..|:||.||:.|||.::.:||:   ..|..|  |||||||.||||:.::|:|:|:
  Rat    10 DKHQLERLDEMMIVVDENDKVIGADTERNCHQ---NKNIEKGLLHRAFSVALFNSEKKVLIQRRA 71

  Fly   103 SHKITFPNTYTNACCSHPLYEIEQERQERNAQGIRVAAQRRLNYELGIPTEELQPQDFRYLTRIH 167
            ..|:|||..||::||||||...| |.:|::|.|::.||.|||..|||||.:::..:|..::.|.|
  Rat    72 DTKLTFPGYYTDSCCSHPLSNPE-EMEEKDALGVKKAALRRLQAELGIPQDQVSLEDIVFMKRYH 135

  Fly   168 YADTGDGVWGEHEIDYILFLQKDVTLRPNSNEVSEVRYLRRDKIDEAV---AKFSAPLTPWFSLI 229
            |....|.||||||:.|:|.::|||.:.|:.:|||...||.|::::|.:   |:....:|||...:
  Rat   136 YKAKSDAVWGEHEVCYLLLIKKDVKICPDPSEVSSFSYLTREELEELLERGARGEVQVTPWLRFV 200

  Fly   230 LQHRLKLWWDNLHQLEQFEDLSNIQR 255
            ::..|..||..|.:..:|.:|..|.|
  Rat   201 VEQFLYAWWPYLDEATRFIELDKIYR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IdiNP_001163673.1 Nudix_Hydrolase 48..256 CDD:294304 90/213 (42%)
Idi 49..233 CDD:224360 82/188 (44%)
RGD1564347XP_038952385.1 Nudix_Hydrolase 1..227 CDD:412381 93/221 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353952
Domainoid 1 1.000 165 1.000 Domainoid score I3816
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 214 1.000 Inparanoid score I3543
OMA 1 1.010 - - QHG54285
OrthoDB 1 1.010 - - D1281908at2759
OrthoFinder 1 1.000 - - FOG0001381
OrthoInspector 1 1.000 - - otm45394
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10885
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X870
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.