DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idi and IDI1

DIOPT Version :9

Sequence 1:NP_001163673.1 Gene:Idi / 42526 FlyBaseID:FBgn0038876 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_004499.2 Gene:IDI1 / 3422 HGNCID:5387 Length:284 Species:Homo sapiens


Alignment Length:219 Identity:109/219 - (49%)
Similarity:144/219 - (65%) Gaps:5/219 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DPLQAHALKEQCILVDANDQAIGAASKADCHRVHPETNDVKLHRAFSVFLFNSQGEMLVQKRSSH 104
            |..|...|.|.|||:|.||..|||.:|.:|| ::.......|||||||||||::.::|:|:||..
Human    67 DKQQVQLLAEMCILIDENDNKIGAETKKNCH-LNENIEKGLLHRAFSVFLFNTENKLLLQQRSDA 130

  Fly   105 KITFPNTYTNACCSHPLYEIEQERQERNAQGIRVAAQRRLNYELGIPTEELQPQDFRYLTRIHYA 169
            |||||..:||.||||||.. ..|.:|.:|.|:|.||||||..|||||.||:.|::..|||||||.
Human   131 KITFPGCFTNTCCSHPLSN-PAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYK 194

  Fly   170 DTGDGVWGEHEIDYILFLQKDVTLRPNSNEVSEVRYLRRDKIDEAVAKFSA---PLTPWFSLILQ 231
            ...||:||||||||||.::|:|||.|:.||:....|:.::::.|.:.|.::   .:||||.:|..
Human   195 AQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAA 259

  Fly   232 HRLKLWWDNLHQLEQFEDLSNIQR 255
            ..|..|||||:.|.||.|...|.|
Human   260 TFLFKWWDNLNHLNQFVDHEKIYR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IdiNP_001163673.1 Nudix_Hydrolase 48..256 CDD:294304 106/211 (50%)
Idi 49..233 CDD:224360 94/186 (51%)
IDI1NP_004499.2 Idi 76..265 CDD:224360 95/190 (50%)
Nudix_Hydrolase 78..284 CDD:294304 105/208 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159888
Domainoid 1 1.000 169 1.000 Domainoid score I3809
eggNOG 1 0.900 - - E1_COG1443
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3315
Inparanoid 1 1.050 219 1.000 Inparanoid score I3581
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54285
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001381
OrthoInspector 1 1.000 - - otm41265
orthoMCL 1 0.900 - - OOG6_102471
Panther 1 1.100 - - LDO PTHR10885
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.