DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idi and LOC102551575

DIOPT Version :9

Sequence 1:NP_001163673.1 Gene:Idi / 42526 FlyBaseID:FBgn0038876 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038952291.1 Gene:LOC102551575 / 102551575 RGDID:7541008 Length:225 Species:Rattus norvegicus


Alignment Length:220 Identity:82/220 - (37%)
Similarity:123/220 - (55%) Gaps:17/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LQAHALKEQCILVDANDQAIGAASKADCHRVHPET-NDVKLHRAFSVFLFNSQGEMLVQKRSSHK 105
            ||...|:|..|::|..||.|||.:|.:||.:  || |...|||.|||.|||:|.::|||:|:..|
  Rat    12 LQIKRLEEILIVIDKQDQIIGADTKKNCHLM--ETINKGLLHRGFSVVLFNTQNQLLVQQRADAK 74

  Fly   106 ITFPNT----YTNACCSHPLYEIEQERQERNAQGIRVAAQRRLNYELGIPTEELQPQDFRYLTRI 166
            .|||..    :|::|.||||| :.:|.:|.:|.|:|.||.|||..|||||.::....|..::.||
  Rat    75 YTFPGEPPRHFTDSCSSHPLY-VPEELEEEDAVGVRRAALRRLQAELGIPQDQTSIMDSIFMNRI 138

  Fly   167 HYADTGDGVWGEHEIDYILFLQKDVTLRPNSNEVSEVRYLRRDKIDEAV---AKFSAPLTPWFSL 228
            ::....|.:||:||..|:...::|      ..||....|:.::.:.|.:   .:....:||||..
  Rat   139 YHKSPSDDIWGDHENGYLSVGEED------PREVRSYSYMSQEDVQELLDRGTRGEEKITPWFRT 197

  Fly   229 ILQHRLKLWWDNLHQLEQFEDLSNI 253
            |.:..|..||.:|..:..|.:...|
  Rat   198 IAEGFLLSWWPHLEDVSPFVEPDKI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IdiNP_001163673.1 Nudix_Hydrolase 48..256 CDD:294304 79/214 (37%)
Idi 49..233 CDD:224360 73/191 (38%)
LOC102551575XP_038952291.1 Nudix_Hydrolase 18..225 CDD:412381 79/214 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54285
OrthoDB 1 1.010 - - D1281908at2759
OrthoFinder 1 1.000 - - FOG0001381
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10885
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X870
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.