DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and AP1S2

DIOPT Version :10

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001259000.1 Gene:AP1S2 / 8905 HGNCID:560 Length:160 Species:Homo sapiens


Alignment Length:134 Identity:65/134 - (48%)
Similarity:94/134 - (70%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGLY 66
            ::|:|:.:|.||.||.|||:...|.||:|:..|:...|..|..|..:|:|:|:.||||:|||.||
Human     1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLY 65

  Fly    67 FCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETSQTKV 131
            ||..::..||.|..||.||.:||:|::||.:|||||::|||.|.|.::||..|.||::|||:..|
Human    66 FCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNV 130

  Fly   132 LKQL 135
            ||.:
Human   131 LKAI 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 65/134 (49%)
AP1S2NP_001259000.1 AP1_sigma 2..144 CDD:341435 65/133 (49%)

Return to query results.
Submit another query.