DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and APS2

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_012592.1 Gene:APS2 / 853521 SGDID:S000003819 Length:147 Species:Saccharomyces cerevisiae


Alignment Length:145 Identity:70/145 - (48%)
Similarity:102/145 - (70%) Gaps:4/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IRFILIQNRAGKTRLAKWY--MNFDDDEKQKLIEEVHAVVTVRDAKH-TNFVEFR-NFKIVYRRY 62
            ::|||..|:.|..||.:|:  .:.|....|..|.:::.:::.||.|| :|||||. :.|::||||
Yeast     3 VQFILCFNKQGVVRLVRWFDVHSSDPQRSQDAIAQIYRLISSRDHKHQSNFVEFSDSTKLIYRRY 67

  Fly    63 AGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETS 127
            |||||.:.||:.|:...||..||.|||||:.:|.||||||:||||||||.::||||:.|||:|.|
Yeast    68 AGLYFVMGVDLLDDEPIYLCHIHLFVEVLDAFFGNVCELDIVFNFYKVYMIMDEMFIGGEIQEIS 132

  Fly   128 QTKVLKQLLTLNSLE 142
            :..:|::|..|:.|:
Yeast   133 KDMLLERLSILDRLD 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 69/142 (49%)
APS2NP_012592.1 longin-like 3..146 CDD:365781 69/142 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346055
Domainoid 1 1.000 135 1.000 Domainoid score I1086
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3001
Inparanoid 1 1.050 136 1.000 Inparanoid score I1211
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 1 1.000 - - oto100151
orthoMCL 1 0.900 - - OOG6_102766
Panther 1 1.100 - - LDO PTHR11753
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R63
SonicParanoid 1 1.000 - - X298
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.