DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and APS1

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_013271.1 Gene:APS1 / 850868 SGDID:S000004160 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:60/144 - (41%)
Similarity:95/144 - (65%) Gaps:4/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGLY 66
            ::::|:.:|.||.||.|||......||.|:::::...:..|..|..|.:|:.:.|:||:|||.||
Yeast     4 LKYLLLVSRQGKIRLKKWYTAMSAGEKAKIVKDLTPTILARKPKMCNIIEYNDHKVVYKRYASLY 68

  Fly    67 FCICV--DVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLA-GEIRETSQ 128
            |.:.:  || ||.|..||.||.|||.::.||.||||||::|||.|||.:::||.:. |.|.|:|:
Yeast    69 FIVGMTPDV-DNELLTLEIIHRFVETMDTYFGNVCELDIIFNFSKVYDILNEMIMCDGSIAESSR 132

  Fly   129 TKVLKQLLTLNSLE 142
            .:||..:..::::|
Yeast   133 KEVLHHVTVMDTME 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 59/141 (42%)
APS1NP_013271.1 AP1_sigma 5..149 CDD:341435 60/143 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X298
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.