DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and AT4G35410

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_195267.1 Gene:AT4G35410 / 829694 AraportID:AT4G35410 Length:162 Species:Arabidopsis thaliana


Alignment Length:133 Identity:67/133 - (50%)
Similarity:97/133 - (72%) Gaps:0/133 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGL 65
            ||.|:|:.:|.||.||.|||..:...|:.|:|.|:..|:..|..|..||||:|.:|:||:|||.|
plant     1 MIHFVLLVSRQGKVRLTKWYSPYAQKERSKVIRELSGVILNRGPKLCNFVEWRGYKVVYKRYASL 65

  Fly    66 YFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETSQTK 130
            |||:|:|..||.|..||.||::||:|:.||.:||||||:|||:|.|.::||:.:|||::|:|:..
plant    66 YFCMCIDQEDNELEVLEIIHHYVEILDRYFGSVCELDLIFNFHKAYYILDELLIAGELQESSKKT 130

  Fly   131 VLK 133
            |.:
plant   131 VAR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 67/133 (50%)
AT4G35410NP_195267.1 APS2 1..150 CDD:227363 67/133 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.