DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and ap1s2

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_012812612.1 Gene:ap1s2 / 733931 XenbaseID:XB-GENE-1006254 Length:166 Species:Xenopus tropicalis


Alignment Length:134 Identity:65/134 - (48%)
Similarity:94/134 - (70%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGLY 66
            ::|:|:.:|.||.||.|||:...|.||:|:..|:...|..|..|..:|:|:|:.||||:|||.||
 Frog     7 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLY 71

  Fly    67 FCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETSQTKV 131
            ||..::..||.|..||.||.:||:|::||.:|||||::|||.|.|.::||..|.||::|||:..|
 Frog    72 FCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNV 136

  Fly   132 LKQL 135
            ||.:
 Frog   137 LKAI 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 65/134 (49%)
ap1s2XP_012812612.1 AP1_sigma 8..150 CDD:341435 65/133 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.