DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and Ap2s1

DIOPT Version :10

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_075241.2 Gene:Ap2s1 / 65046 RGDID:620188 Length:142 Species:Rattus norvegicus


Alignment Length:142 Identity:136/142 - (95%)
Similarity:138/142 - (97%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGL 65
            |||||||||||||||||||||.|||||||||||||||||||||||||||||||||||:|||||||
  Rat     1 MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGL 65

  Fly    66 YFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETSQTK 130
            |||||||||||||.||||||||||||||||||||||||||||||||:||||||||||||||||||
  Rat    66 YFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTK 130

  Fly   131 VLKQLLTLNSLE 142
            ||||||.|.|||
  Rat   131 VLKQLLMLQSLE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 133/139 (96%)
Ap2s1NP_075241.2 AP2_sigma 1..141 CDD:341437 133/139 (96%)

Return to query results.
Submit another query.