DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and ap1s3a

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_009290225.1 Gene:ap1s3a / 550415 ZFINID:ZDB-GENE-050417-222 Length:163 Species:Danio rerio


Alignment Length:141 Identity:64/141 - (45%)
Similarity:97/141 - (68%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGLY 66
            :||:|:.:|.||.||.||:....|.:|:|:|.::..:|..|..|..||:.:|:.||||||||.||
Zfish    11 MRFLLLFSRQGKLRLQKWFTVLSDRDKRKIIRDLTQMVLSRPPKACNFLPWRDLKIVYRRYASLY 75

  Fly    67 FCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETSQTKV 131
            ||..::.:||.|..|:.:|.:||:|::||.||||||::|||.|.|.::||..:.||::|||:..|
Zfish    76 FCCGLEQDDNELLTLDILHRYVELLDQYFGNVCELDIIFNFEKAYFILDEFVIGGEVQETSKASV 140

  Fly   132 LKQLLTLNSLE 142
            .|.:....||:
Zfish   141 AKSIEEAESLQ 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 62/138 (45%)
ap1s3aXP_009290225.1 Clat_adaptor_s 10..151 CDD:250451 63/139 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.