DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and ap4s1

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001016360.1 Gene:ap4s1 / 549114 XenbaseID:XB-GENE-941798 Length:144 Species:Xenopus tropicalis


Alignment Length:141 Identity:57/141 - (40%)
Similarity:93/141 - (65%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGL 65
            ||:|.||.|:.|:|||:::|...:...:..|..:|..:...|.....:|:|:::||:|||:||.|
 Frog     1 MIKFFLIVNKQGQTRLSRYYERMEVQRRTLLESDVIKLCLSRSKDQCSFIEYKDFKLVYRQYASL 65

  Fly    66 YFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETSQTK 130
            :..:.:|.::|.:...|.||||||||::||..|.|||::||..||:.::|||.|.|...||::|:
 Frog    66 FIVVGIDESENEMAVFELIHNFVEVLDKYFSRVSELDIMFNLDKVHIILDEMLLNGSAVETNKTR 130

  Fly   131 VLKQLLTLNSL 141
            :|..||.|:.:
 Frog   131 ILAPLLVLDKV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 57/139 (41%)
ap4s1NP_001016360.1 AP4_sigma 3..140 CDD:341436 55/136 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.