DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and ap3s2

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001002539.1 Gene:ap3s2 / 436812 ZFINID:ZDB-GENE-040718-274 Length:192 Species:Danio rerio


Alignment Length:148 Identity:58/148 - (39%)
Similarity:92/148 - (62%) Gaps:6/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVE------FRNFKIVY 59
            ||:.|||.|..||.||.::|..|.:|.:|::|.|...:|:.||....||:|      ..::|::|
Zfish     1 MIKAILIFNNHGKPRLIRFYQYFAEDMQQQIIRETFHLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65

  Fly    60 RRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIR 124
            |.||.|||..|||.:::.|..|:.|..|||.|::.|.|||||||:|:..||:.::.|:.:.|.:.
Zfish    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVL 130

  Fly   125 ETSQTKVLKQLLTLNSLE 142
            ||:..:::.|:...|.:|
Zfish   131 ETNMNEIVAQVELQNRME 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 57/145 (39%)
ap3s2NP_001002539.1 AP3_sigma 1..146 CDD:341438 56/144 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.