DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and ap4s1

DIOPT Version :10

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_005158818.1 Gene:ap4s1 / 368852 ZFINID:ZDB-GENE-030616-404 Length:144 Species:Danio rerio


Alignment Length:141 Identity:59/141 - (41%)
Similarity:94/141 - (66%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGL 65
            ||:|:|:.|:.|:|||:|:|...|..::..|..:|......|..:..:|||::::|:|||:||.|
Zfish     1 MIKFLLMVNKQGQTRLSKYYEAVDLGKRAALEADVVRGCLARRKEECSFVEYKDYKLVYRQYAAL 65

  Fly    66 YFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETSQTK 130
            :..:.|..|:|.|...|.:|||||||::||..|.|||::||..||:.::|||.|.|.|.||::.:
Zfish    66 FIVVGVTENENELSIYELVHNFVEVLDKYFSRVSELDIMFNLDKVHIILDEMILNGHIVETNKNR 130

  Fly   131 VLKQLLTLNSL 141
            :|..||.|:.:
Zfish   131 ILAPLLALDKM 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 59/139 (42%)
ap4s1XP_005158818.1 AP4_sigma 3..140 CDD:341436 57/136 (42%)

Return to query results.
Submit another query.