DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and zgc:162858

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001082809.1 Gene:zgc:162858 / 337771 ZFINID:ZDB-GENE-030131-7909 Length:181 Species:Danio rerio


Alignment Length:134 Identity:64/134 - (47%)
Similarity:92/134 - (68%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGLY 66
            ::|:|:.:|.||.||.|||:...|.||:|:..|:...|..|..|..:|:|:|:.||||:|||.||
Zfish    25 MQFMLLFSRQGKLRLQKWYVPLCDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLY 89

  Fly    67 FCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETSQTKV 131
            ||..::..||.|..||.||.:||:|::||.:||.||::|||.|.|.::||..|.||.:|||:..|
Zfish    90 FCCAIEDQDNELITLEIIHRYVELLDKYFGSVCGLDIIFNFEKAYFILDEFLLGGEAQETSKKNV 154

  Fly   132 LKQL 135
            ||.:
Zfish   155 LKAI 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 64/134 (48%)
zgc:162858NP_001082809.1 Clat_adaptor_s 25..165 CDD:250451 64/134 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.