DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and vas2

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_593410.1 Gene:vas2 / 2542885 PomBaseID:SPAP27G11.06c Length:162 Species:Schizosaccharomyces pombe


Alignment Length:135 Identity:69/135 - (51%)
Similarity:95/135 - (70%) Gaps:0/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGLY 66
            |:|.|:.:|.||.|||||:......|:.|:|.:|.::|..|..|..||||::..||||||||.|:
pombe     3 IKFFLLVSRQGKVRLAKWFNTLSIKERAKIIRDVSSLVITRKPKMCNFVEYKGEKIVYRRYASLF 67

  Fly    67 FCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETSQTKV 131
            |...::.:||.|..||.||.|||.|::||.|||||||:|||.|.|.|::|:.||||::|:|:|.|
pombe    68 FVCGIEQDDNELIILEVIHKFVECLDKYFGNVCELDLIFNFEKAYYVMEELLLAGELQESSKTNV 132

  Fly   132 LKQLL 136
            |..:|
pombe   133 LSAVL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 69/135 (51%)
vas2NP_593410.1 APS2 2..153 CDD:227363 69/135 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X298
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.