DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and aps2

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_596138.1 Gene:aps2 / 2541086 PomBaseID:SPBC685.04c Length:143 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:81/143 - (56%)
Similarity:109/143 - (76%) Gaps:1/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAK-HTNFVEFRNFKIVYRRYAG 64
            ||:|||||||.||.||:|:|:.||||||.:|...:|.:::.|:.| ..||:|:.|.|:|||||||
pombe     1 MIQFILIQNRHGKNRLSKYYVPFDDDEKVRLKARIHQLISQRNQKFQANFLEWENSKLVYRRYAG 65

  Fly    65 LYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETSQT 129
            ||||.|||..||:|..||.||.|||:|:.:|.|||||||:||||||.:::||:.|.|||.|:::.
pombe    66 LYFCFCVDSTDNDLAILEMIHFFVEILDSFFGNVCELDLIFNFYKVSAILDEIILGGEIGESNKK 130

  Fly   130 KVLKQLLTLNSLE 142
            .||:::..|..||
pombe   131 SVLERIEALEKLE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 79/140 (56%)
aps2NP_596138.1 APS2 1..143 CDD:227363 79/141 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 169 1.000 Domainoid score I908
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3001
Inparanoid 1 1.050 171 1.000 Inparanoid score I1186
OMA 1 1.010 - - QHG53551
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 1 1.000 - - oto101899
orthoMCL 1 0.900 - - OOG6_102766
Panther 1 1.100 - - LDO PTHR11753
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R63
SonicParanoid 1 1.000 - - X298
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.