DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and AP4S1

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_009008.2 Gene:AP4S1 / 11154 HGNCID:575 Length:159 Species:Homo sapiens


Alignment Length:140 Identity:51/140 - (36%)
Similarity:82/140 - (58%) Gaps:11/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGL 65
            ||:|.|:.|:.|:|||:|:|.:.|.:::..|..||......|..:..:|:|:::||::||:||.|
Human     1 MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYRQYAAL 65

  Fly    66 YFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDL-VFN--FYKVYSV--------VDEMFL 119
            :..:.|:..:|.:...|.||||||||:|||..|.|||: .||  |:..:.:        :||:..
Human    66 FIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDVSFFNTVFHSTWQMHSGPYQEPIDELPK 130

  Fly   120 AGEIRETSQT 129
            .....|..||
Human   131 ICSALEPQQT 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 51/140 (36%)
AP4S1NP_009008.2 Clat_adaptor_s 1..>105 CDD:261170 43/103 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.