DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and Ap1s2

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001277308.1 Gene:Ap1s2 / 108012 MGIID:1889383 Length:160 Species:Mus musculus


Alignment Length:134 Identity:65/134 - (48%)
Similarity:94/134 - (70%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGLY 66
            ::|:|:.:|.||.||.|||:...|.||:|:..|:...|..|..|..:|:|:|:.||||:|||.||
Mouse     1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLY 65

  Fly    67 FCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETSQTKV 131
            ||..::..||.|..||.||.:||:|::||.:|||||::|||.|.|.::||..|.||::|||:..|
Mouse    66 FCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNV 130

  Fly   132 LKQL 135
            ||.:
Mouse   131 LKAI 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 65/134 (49%)
Ap1s2NP_001277308.1 AP1_sigma 2..144 CDD:341435 65/133 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1307450at2759
OrthoFinder 1 1.000 - - FOG0000441
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.