DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2sigma and ARPIN-AP3S2

DIOPT Version :9

Sequence 1:NP_650961.2 Gene:AP-2sigma / 42525 FlyBaseID:FBgn0043012 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001185987.1 Gene:ARPIN-AP3S2 / 100526783 HGNCID:38824 Length:394 Species:Homo sapiens


Alignment Length:162 Identity:53/162 - (32%)
Similarity:84/162 - (51%) Gaps:32/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GKTRLAKWYMNF--------------------DDDE-----KQKLIEEVHAVVTVRDAKHTNFVE 51
            |||. |.|..|.                    :|:|     :|:::.|...:|..||....||:|
Human   189 GKTG-ASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWPEEIQQQIVRETFHLVLKRDDNICNFLE 252

  Fly    52 ------FRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKV 110
                  ..::|::||.||.|||..|||.:::.|..|:.|..|||.|::.|.|||||||:|:..||
Human   253 GGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKV 317

  Fly   111 YSVVDEMFLAGEIRETSQTKVLKQLLTLNSLE 142
            :.::.|:.:.|.:.||:..:::.|:...|.||
Human   318 HYILQEVVMGGMVLETNMNEIVAQIEAQNRLE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2sigmaNP_650961.2 AP2_sigma 1..141 CDD:341437 51/159 (32%)
ARPIN-AP3S2NP_001185987.1 UPF0552 1..224 CDD:287536 7/35 (20%)
APS2 226..349 CDD:227363 43/122 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.