Sequence 1: | NP_732610.1 | Gene: | Rab1 / 42524 | FlyBaseID: | FBgn0285937 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004274.1 | Gene: | RAB3D / 9545 | HGNCID: | 9779 | Length: | 219 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 91/206 - (44%) |
---|---|---|---|
Similarity: | 129/206 - (62%) | Gaps: | 3/206 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 SVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDT 67
Fly 68 AGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKK 132
Fly 133 VVDHTTAAEYAAQLGIPFLETSAKSATNVEQAF---MTMAAEIKNRVGPPSSATDNASKVKIDQG 194
Fly 195 RPVENTKSGCC 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab1 | NP_732610.1 | Rab1_Ypt1 | 10..175 | CDD:206661 | 82/167 (49%) |
RAB3D | NP_004274.1 | Rab3 | 22..186 | CDD:206657 | 80/163 (49%) |
Effector region. /evidence=ECO:0000250 | 51..59 | 3/7 (43%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 190..219 | 6/28 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |