DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and SEC4

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_116650.1 Gene:SEC4 / 850543 SGDID:S000001889 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:103/204 - (50%)
Similarity:143/204 - (70%) Gaps:11/204 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQER 72
            ||.:.|:||||||||||||||:||.:|.:..|:|:|||:||||:|::::||.:|||:||||||||
Yeast    17 YDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQER 81

  Fly    73 FRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHT 137
            |||||::|||||.|||:|||.||:.:|.|:|||.:.:..:|.:....||||||||:.| :||...
Yeast    82 FRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMET-RVVTAD 145

  Fly   138 TAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNR------VGPPSSATDNASKVKIDQGRP 196
            .....|.:|||||:|:|||:..||.:.|.|:|..|:.:      ||..:....|   :.|:.|..
Yeast   146 QGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGVGNGKEGN---ISINSGSG 207

  Fly   197 VENTKSGCC 205
             .::||.||
Yeast   208 -NSSKSNCC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 92/164 (56%)
SEC4NP_116650.1 Rab8_Rab10_Rab13_like 18..183 CDD:206659 93/165 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.