DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and RA-5

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_171715.1 Gene:RA-5 / 837023 AraportID:AT1G02130 Length:203 Species:Arabidopsis thaliana


Alignment Length:203 Identity:149/203 - (73%)
Similarity:171/203 - (84%) Gaps:3/203 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTA 68
            :|||||||||||||||||||||||||||:||:|.|||||||||||||||:|.|||||||||||||
plant     1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFSDDSYVESYISTIGVDFKIRTVEQDGKTIKLQIWDTA 65

  Fly    69 GQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKV 133
            ||||||||||||||||||||:|||.||:||||||||||.||:|||.:||||||||||||||..:.
plant    66 GQERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKSDLTENRA 130

  Fly   134 VDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKID-QGRPV 197
            :.:.||..:|.::||||:|||||.|||||||||.|:|.||.|:. ...|.:||....:. :|:||
plant   131 IPYETAKAFADEIGIPFMETSAKDATNVEQAFMAMSASIKERMA-SQPAGNNARPPTVQIRGQPV 194

  Fly   198 ENTKSGCC 205
            .. |:|||
plant   195 AQ-KNGCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 133/164 (81%)
RA-5NP_171715.1 Rab1_Ypt1 7..172 CDD:206661 133/164 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 269 1.000 Domainoid score I443
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36154
Inparanoid 1 1.050 301 1.000 Inparanoid score I782
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0001193
OrthoInspector 1 1.000 - - otm2518
orthoMCL 1 0.900 - - OOG6_101123
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X737
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.730

Return to query results.
Submit another query.