DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and RABA1c

DIOPT Version :10

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_199387.1 Gene:RABA1c / 834614 AraportID:AT5G45750 Length:216 Species:Arabidopsis thaliana


Alignment Length:206 Identity:99/206 - (48%)
Similarity:133/206 - (64%) Gaps:7/206 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQE 71
            |||||||::||||||||||.||.||..:.::....|||||:|..|::.:|.|.||.|||||||||
plant     9 EYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLNVDDKVIKAQIWDTAGQE 73

  Fly    72 RFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDH 136
            |:|.|||:|||||.|.::|||.|...:|.||:.||:|:..:...|:..:||||||||.....|..
plant    74 RYRAITSAYYRGAVGALLVYDVTRHSTFENVETWLKELRNHTDPNIVVMLVGNKSDLRHLVAVQT 138

  Fly   137 TTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPS--SATDNASKV----KIDQGR 195
            ..|..:|.:..:.|:||||..|||||.||..:..:|.:.|...:  :|:::|:..    |||.|:
plant   139 EDAKSFAEKESLYFMETSALEATNVENAFAEVLTQIHHIVSKKAMEAASESANVPSKGDKIDIGK 203

  Fly   196 PVENT-KSGCC 205
            .|... |.|||
plant   204 DVSAVKKGGCC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 84/164 (51%)
RABA1cNP_199387.1 Rab11_like 11..175 CDD:206660 84/163 (52%)

Return to query results.
Submit another query.