DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and RAB1C

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_193486.1 Gene:RAB1C / 827468 AraportID:AT4G17530 Length:202 Species:Arabidopsis thaliana


Alignment Length:202 Identity:153/202 - (75%)
Similarity:170/202 - (84%) Gaps:2/202 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTA 68
            :||||||||||||||||||||||||||||||:|.:||||||||||||||:|.|||||||||||||
plant     1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTA 65

  Fly    69 GQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKV 133
            |||||||||||||||||||||.||.||.||||||||||.||:|||.|||||||||||.|||::||
plant    66 GQERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTSQKV 130

  Fly   134 VDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKIDQGRPVE 198
            |...||..:|.:|||||||||||:|||||:|||.|.|.||.|:....:.......|:| :|:|| 
plant   131 VSTETAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIKTRMASQPAGGSKPPTVQI-RGQPV- 193

  Fly   199 NTKSGCC 205
            |.:||||
plant   194 NQQSGCC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 137/164 (84%)
RAB1CNP_193486.1 Rab1_Ypt1 7..172 CDD:206661 137/164 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 269 1.000 Domainoid score I443
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 301 1.000 Inparanoid score I782
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0001193
OrthoInspector 1 1.000 - - otm2518
orthoMCL 1 0.900 - - OOG6_101123
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X737
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.