DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and RAB1B

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_016873867.1 Gene:RAB1B / 81876 HGNCID:18370 Length:237 Species:Homo sapiens


Alignment Length:238 Identity:168/238 - (70%)
Similarity:181/238 - (76%) Gaps:37/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTA 68
            :||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Human     1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTA 65

  Fly    69 GQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKV 133
            ||||||||||||||||||||||||.|||||:.||||||:||:|||.|||||||||||||||||||
Human    66 GQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKV 130

  Fly   134 VDHTTA------------------------------------AEYAAQLGIPFLETSAKSATNVE 162
            ||:|||                                    .|:|..|||||||||||:|||||
Human   131 VDNTTAKVADGPVCPGSGRWGLLPLTCSPLLFSPLLFSPLPCQEFADSLGIPFLETSAKNATNVE 195

  Fly   163 QAFMTMAAEIKNRVGPPSSATDNASKVKIDQGRPVENTKSGCC 205
            |||||||||||.|:||.:::......:||| ..||:....|||
Human   196 QAFMTMAAEIKKRMGPGAASGGERPNLKID-STPVKPAGGGCC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 152/200 (76%)
RAB1BXP_016873867.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 297 1.000 Domainoid score I1466
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 341 1.000 Inparanoid score I2359
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0001193
OrthoInspector 1 1.000 - - otm41004
orthoMCL 1 0.900 - - OOG6_101123
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1997
SonicParanoid 1 1.000 - - X737
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.