DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab1a

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_112352.2 Gene:Rab1a / 81754 RGDID:619736 Length:205 Species:Rattus norvegicus


Alignment Length:206 Identity:174/206 - (84%)
Similarity:186/206 - (90%) Gaps:2/206 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIW 65
            |||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIW 65

  Fly    66 DTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTT 130
            |||||||||||||||||||||||||||.|||||||||||||:||:|||.|||||||||||.||||
  Rat    66 DTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTT 130

  Fly   131 KKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATD-NASKVKIDQG 194
            |||||:|||.|:|..|||||||||||:||||||:|||||||||.|:||.::|.. ..|.||| |.
  Rat   131 KKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKI-QS 194

  Fly   195 RPVENTKSGCC 205
            .||:.:..|||
  Rat   195 TPVKQSGGGCC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 152/164 (93%)
Rab1aNP_112352.2 Rab1_Ypt1 10..175 CDD:206661 152/164 (93%)
Effector region. /evidence=ECO:0000255 40..48 7/7 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..205 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342157
Domainoid 1 1.000 297 1.000 Domainoid score I1406
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36154
Inparanoid 1 1.050 341 1.000 Inparanoid score I2277
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0001193
OrthoInspector 1 1.000 - - otm45140
orthoMCL 1 0.900 - - OOG6_101123
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X737
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.