DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and rab33a

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001072527.1 Gene:rab33a / 779982 XenbaseID:XB-GENE-494412 Length:215 Species:Xenopus tropicalis


Alignment Length:174 Identity:79/174 - (45%)
Similarity:113/174 - (64%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFR- 74
            :||:::||||.|||:||..||....:..|..:||||||:.:|:|:||:.||:|:|||||||||| 
 Frog    17 IFKIIVIGDSNVGKTCLTFRFCGGGFPGSSEATIGVDFREKTVEIDGEKIKVQVWDTAGQERFRH 81

  Fly    75 TITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACEN-VNKLLVGNKSDLTTKKVVDHTT 138
            ::...|||..||::.|||.|...||:|::.||:|.|.:|... |.::|||||.||..:..|....
 Frog    82 SLVEHYYRNVHGVVFVYDVTKLSSFHNLRTWLQECEGHAVPALVPRVLVGNKCDLLEQVEVPSGL 146

  Fly   139 AAEYAAQLGIPFLETSAK---SATNVEQAFMTMAAEIKNRVGPP 179
            |..:|....:...|||||   .|.|||:.||::|.::|.:...|
 Frog   147 ALNFAKAHKMVLFETSAKDPSQAKNVEKIFMSLACQLKAQKSLP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 78/168 (46%)
rab33aNP_001072527.1 Rab33B_Rab33A 16..185 CDD:133315 77/167 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.