DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and rab12

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_002937521.2 Gene:rab12 / 779581 XenbaseID:XB-GENE-492791 Length:248 Species:Xenopus tropicalis


Alignment Length:169 Identity:81/169 - (47%)
Similarity:119/169 - (70%) Gaps:1/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERF 73
            |:..::::||..||||:.|:.||.|||:.|:..||:||||||:|:||.||.|:||||||||||||
 Frog    44 DFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERF 108

  Fly    74 RTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHTT 138
            .:|||:|||.|.|||:|||.|.:|:|.::.:|::.|::||.|....||||||.|..|.:.:....
 Frog   109 NSITSAYYRSAKGIILVYDITKKETFEDLPKWMKMIDKYASEEAELLLVGNKLDCETDREITRQQ 173

  Fly   139 AAEYAAQL-GIPFLETSAKSATNVEQAFMTMAAEIKNRV 176
            ..::|.|: |:.|.|.|||...||::.|:.:..:|..::
 Frog   174 GEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKM 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 80/165 (48%)
rab12XP_002937521.2 P-loop_NTPase 47..248 CDD:393306 80/166 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.