DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and rab43

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001038812.1 Gene:rab43 / 751627 ZFINID:ZDB-GENE-060825-25 Length:208 Species:Danio rerio


Alignment Length:198 Identity:90/198 - (45%)
Similarity:130/198 - (65%) Gaps:2/198 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQER 72
            ||.:||::|:||.||||:|::.||....:.|...:||||||.::|:|:.||.:||||||||||||
Zfish    10 YDLVFKIVLVGDVGVGKTCVVQRFKTGIFIEKQGNTIGVDFTMKTLEIHGKRVKLQIWDTAGQER 74

  Fly    73 FRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHT 137
            |||||.||||.|:|.|:.||.|.:.:|.:|.:|:|::::|...|:..||:|||.||:..:.|...
Zfish    75 FRTITQSYYRSANGAIITYDITKKATFLSVPKWMEDVKKYGGSNIVPLLIGNKCDLSESREVPLE 139

  Fly   138 TAAEYAAQLG-IPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKIDQGRPVENTK 201
            .|...|.||. :..:|||||.::||::||..||:|:..|.|.|....:.....|: .|:.|....
Zfish   140 DAQTMAHQLDFVSAIETSAKDSSNVDEAFNKMASELILRHGGPMFTENVTDSFKL-TGKDVAGEG 203

  Fly   202 SGC 204
            .||
Zfish   204 WGC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 80/165 (48%)
rab43NP_001038812.1 P-loop_NTPase 11..175 CDD:304359 80/163 (49%)
RAB 14..178 CDD:197555 80/163 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.